Dataset for protein Bcl-2 of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W5KV00_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNELMISPRPGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLNWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A4W5NW18_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho GN=BCL-2 (length=228 residues).
MMANENPYDSRFIVEKYIHHKLLKMGFVWKFQAENDYPNNGFGDPSAPNTREVFARRSQPTAAGEDTDSPYQNRSPQPDP
HARLNRVLREAGDEIGRIYHPDFAEMSGQLHFTPNTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
© 1998-2020Legal notice