Dataset for protein Bcl-2 of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5KV00_BCL2-01      -MAND---DNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNELMISPR
A0A4W5NW18_BCL2-01      MMANENPYDSRFIVEKYIHHKLLKMGFVWKFQAENDYPNNGFGDPSAPNT
                         ***:   *.******** ***** *:.*.*:  ::  . . .:   .  

A0A4W5KV00_BCL2-01      PGLARRCHGANNAGPGSVPRLSKWLSQPDPHAAIHRVLREAGDELERLYQ
A0A4W5NW18_BCL2-01      REVFARRSQPTAAGEDTDSPYQNRSPQPDPHARLNRVLREAGDEIGRIYH
                          :  *   .. ** .: .  .:. .****** ::*********: *:*:

A0A4W5KV00_BCL2-01      PDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICV
A0A4W5NW18_BCL2-01      PDFAEMSGQLHFTPNTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCV
                        ******* **::*..**:***  ****** ********:********:**

A0A4W5KV00_BCL2-01      ECVNKEMTSQVDHIAVWMTEYLNGPLLNWIQENGGWEAFVELYDRQRDSV
A0A4W5NW18_BCL2-01      ESVNREMTSQVDNIARWMTEYLNGPLQNWIQENGGWDAFVEIYEQQR--I
                        *.**.*******:** ********** *********:****:*:.**  :

A0A4W5KV00_BCL2-01      FCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A4W5NW18_BCL2-01      SHSWPYLKTVFGLAALGAAGVTIGALFTQK
                          *** :************.:**** :***

© 1998-2020Legal notice