Dataset for protein BCL-2-like of organism Hippocampus comes

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3Q2XQX2_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes GN=BCL-2 (length=193 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAGEEDDRSHGSDPLADIHRVLREAGDELERLYQPDFTEMSRQLYLSSTTAQR
RFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNGGWDAFVELYDRQRD
SVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2XQX2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hippocampus comes GN=BCL-2 (length=225 residues).
MANERNRTIVENYICHKLSKRGYAWGFGAEDDAAAANNGLLVAPSPTLVLRCREASSGPERDCAPKRSHGSDPLADIHRV
LREAGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECATKEDMTSQVDNIAE
WMTEYLNGPLGSWIQDNGGWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A3Q2XZL8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes GN=MCL-1 (length=289 residues).
MSMVQPTSQVLKPQGRPMRPQNGVAEGLLQCNSPPVAAASTSPPQLHRAVATLGAVNCNSGAAKPRPSALEILCKGGLAT
MNHRNNSDDDFDVESSDDSPPSTPDSQDSLVADGRNDVVDAETKGLIRRFLTDFTGLSTASWNESKAHSTMKRVVAKVLE
KHKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGTTNWGRVASLVAFGAIVSQHLKEKGRAHCVEPVADEISSYLLSH
QRNWLVKNNSWDGFVQFFREVDPESTVRNTLMAFAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A3Q2Y539_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hippocampus comes GN=MCL-1 (length=237 residues).
MPESKRFPLYNFKVGLVDALMLPPKAVVQGSMASQLQEVERRSDNSDMDEGAQPLPELQTPPGQGVLDTETRRLIGRFLR
DFTGLSTAAWIQSKAQSTMKRVVTRLVDKHRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGNINWGRIASLLAFCAV
LSQALKENQQERCVELVAQEVSTYLLSHQRTWLVQHNGWDGFAEFFKEDDLESTVRNGLFAFVGLVSVTAALRCLIR
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3Q3DUT7_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Hippocampus comes GN=BCL2L1 (length=225 residues).
MSQNRELVLFYIRYKLSQKNYPLNHIGLRQALNRTDGREEASGEEEQRVQTPANGTTNGTSPPASPLREAASLDAVKEAL
RDSANEFELRYSHAFSDLDKQLHITPATAYQSFENVVDEVFQDDVNWGRIVGLFAFGGALCVECMEKEMIPLVDRIIEWM
TVYLDNHLQPWIESQGGWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
© 1998-2020Legal notice