Dataset for protein BCL-2-like of organism Hippocampus comes

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2XZL8_MCL1-01      MSMVQPTSQVLKPQGRPMRPQNGVAEGLLQCNSPPVAAASTSPPQLHRAV
A0A3Q2Y539_MCL1-01      -----------MPESKRF-PLYNFKVGLVDALMLP------------PKA
A0A3Q3DUT7_BCL2L1-      -----------MSQNREL-VLFYIRYKLSQKNYPL------------NHI
A0A3Q3DUT7_BCL2L1-      -----------MSQNREL-VLFYIRYKLSQKNYPL------------NHI
A0A3Q3DUT7_BCL2L1-      -----------MSQNREL-VLFYIRYKLSQKNYPL------------NHI
A0A3Q2XQX2_BCL2-02      ---------MANERNRTI-VENYICHKLSKRGYAW------------GFG
A0A3Q2XQX2_BCL2-01      ---------MANERNRTI-VENYICHKLSKRGYAW------------GFG
                                      .. :     .   * .                    

A0A3Q2XZL8_MCL1-01      ATLGAVNCNSGAAKPRPSALEILCKGGLATMNHRNNSDDDFDVESSDDSP
A0A3Q2Y539_MCL1-01      VVQGSMASQL--------------Q--------------EVERRSDNSDM
A0A3Q3DUT7_BCL2L1-      GLRQALNRTDG-------------R--------------EEASGEEEQRV
A0A3Q3DUT7_BCL2L1-      GLRQALNRTDG-------------R--------------EEASGEEEQRV
A0A3Q3DUT7_BCL2L1-      GLRQALNRTDG-------------R--------------EEASGEEEQRV
A0A3Q2XQX2_BCL2-02      AGEED---------------------------------------------
A0A3Q2XQX2_BCL2-01      AEDDAAAANNGLLVAPSPTLVLRCR--------------EASSGPERDCA
                                                                          

A0A3Q2XZL8_MCL1-01      PSTPDSQDSLVADGRNDVVDAETKGLIRRFLTDFTGLSTASWNESKAHST
A0A3Q2Y539_MCL1-01      DEGAQPLPELQTPPGQGVLDTETRRLIGRFLRDFTGLSTAAWIQSKAQST
A0A3Q3DUT7_BCL2L1-      QTPANGTTNGTSPPASPLREAASLDAVKEALRD-----------------
A0A3Q3DUT7_BCL2L1-      QTPANGTTNGTSPPASPLREAASLDAVKEALRD-----------------
A0A3Q3DUT7_BCL2L1-      QTPANGTTNGTSPPASPLREAASLDAVKEALRD-----------------
A0A3Q2XQX2_BCL2-02      -DRSHGSD--------------PLADIHRVLRE-----------------
A0A3Q2XQX2_BCL2-01      PKRSHGSD--------------PLADIHRVLRE-----------------
                           .                  .   :   * :                 

A0A3Q2XZL8_MCL1-01      MKRVVAKVLEKHKYKYNGIINKLSLDDRGDNVSFISEVAKSLFSDGTTNW
A0A3Q2Y539_MCL1-01      MKRVVTRLVDKHRILFNNMVNELSLDQRGLDRSFVSQVAQTEFANGNINW
A0A3Q3DUT7_BCL2L1-      ---SANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDDVNW
A0A3Q3DUT7_BCL2L1-      ---SANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDDVNW
A0A3Q3DUT7_BCL2L1-      ---SANEFELRYSHAFSDLDKQLHITPATAYQSFENVV--DEVFQDDVNW
A0A3Q2XQX2_BCL2-02      ---AGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVI--DELFRDGVNW
A0A3Q2XQX2_BCL2-01      ---AGDELERLYQPDFTEMSRQLYLSSTTAQRRFAEVI--DELFRDGVNW
                               .   :   :. : .:* :        * . :    .  .  **

A0A3Q2XZL8_MCL1-01      GRVASLVAFGAIVSQHLKEKG-RAHCVEPVADEISSYLLSHQRNWLVKNN
A0A3Q2Y539_MCL1-01      GRIASLLAFCAVLSQALKENQ-QERCVELVAQEVSTYLLSHQRTWLVQHN
A0A3Q3DUT7_BCL2L1-      GRIVGLFAFGGALCVECMEKE-MIPLVDRIIEWMTVYLDNHLQPWIESQG
A0A3Q3DUT7_BCL2L1-      GRIVGLFAFGGALCVECMEKE-MIPLVDRIIEWMTVYLDNHLQPWIESQG
A0A3Q3DUT7_BCL2L1-      GRIVGLFAFGGALCVECMEKE-MIPLVDRIIEWMTVYLDNHLQPWIESQG
A0A3Q2XQX2_BCL2-02      GRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNG
A0A3Q2XQX2_BCL2-01      GRIIAFFEFGGTVCVECATKEDMTSQVDNIAEWMTEYLNGPLGSWIQDNG
                        **: .:. * . :.     :      *: : : :: ** .    *: .:.

A0A3Q2XZL8_MCL1-01      SWDGFVQFFREVDPESTVRN-----TLMAFAGVAGIGATLALLIR----
A0A3Q2Y539_MCL1-01      GWDGFAEFFKEDDLESTVRN-----GLFAFVGLVSVTAALRCLIR----
A0A3Q3DUT7_BCL2L1-      GWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
A0A3Q3DUT7_BCL2L1-      GWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
A0A3Q3DUT7_BCL2L1-      GWQRFAEIFGHDAAAEVRRSQESFKKWLLAGVTLVTGVVVGSLIAQKRL
A0A3Q2XQX2_BCL2-02      GWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A3Q2XQX2_BCL2-01      GWDAFVELYDRQRDSVFSCTWPSIKTVFGLAALGAASLTIGAYLTQK--
                        .*: *.:::          .       :          .:   :     

© 1998-2020Legal notice