Dataset for protein Bcl-xL of organism Gouania willdenowi

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C5D4L1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Gouania willdenowi GN=BCL2L1 (length=201 residues).
MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTVVEKEKASPTAGNGLQDRDGVIPPRHGDDDVEAVKLALVESADE
FELLFTQAFNDLATQLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMSELVPRIADWMTMYLDE
NINEWIESEGGGWRTTLMGHIPHIAEHSASVIPGNISVGWM
>gnl|bcl2dbpro|A0A8C5D4L1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gouania willdenowi GN=BCL2L1 (length=257 residues).
MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTVVEKEKASPTAGNGLQDRDGVIPPRHGDDDVEAVKLALVESADE
FELLFTQAFNDLATQLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMSELVPRIADWMTMYLDE
NINEWIESEGGGWASFAQIFGQDAAAKARKARTSMKRWFLFGAVVLTGVLFLVCYVKRREPHLWVTYLTLLNTAPLSYQE
IFLLDGCNITSSSIPHS
>gnl|bcl2dbpro|A0A8C5D4L1_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Gouania willdenowi GN=BCL2L1 (length=219 residues).
MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTVVEKEKASPTAGNGLQDRDGVIPPRHGDDDVEAVKLALVESADE
FELLFTQAFNDLATQLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMSELVPRIADWMTMYLDE
NINEWIESEGGGWASFAQIFGQDAAAKARKARTSMKRWFLFGAVVLTGVLFLVCYVKRR
>gnl|bcl2dbpro|A0A8C5G971_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gouania willdenowi GN=BCL2L1 (length=224 residues).
MTQNRELVVFYITYKLSQRNYPLDHIVLNEPPHRTAGSDAEPAEDERTDTQSNGTLNASPVQQQRLPSATSLDAVKEALR
DTANEFELRYSLAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEWMT
VYLDNHIQPWIQSQGGWERFAEVFGQDAVAEIRRSEESFKKWLLVGMTVVTGVVVGSLFAQKRL
© 1998-2022Legal notice