Dataset for protein Bcl-xL of organism Gouania willdenowi

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5G971_BCL2L1-      -MTQNRELVVFYITYKLSQRNYPLDHIVLNEPPHRTAGSDAEPAEDERTD
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTV-----VEKEKASP
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTV-----VEKEKASP
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCHRLAQRDFPTSPLRLQDTRDRTV-----VEKEKASP
                          . ***** *:: :.*:**::* . : *::.  **.       ::: : 

A0A8C5G971_BCL2L1-      TQSNGTLNASPVQQQRLPSATSLDAVKEALRDTANEFELRYSLAFSDLHS
A0A8C5D4L1_BCL2L1-      TAGNGLQDRDGVIPPR-HGDDDVEAVKLALVESADEFELLFTQAFNDLAT
A0A8C5D4L1_BCL2L1-      TAGNGLQDRDGVIPPR-HGDDDVEAVKLALVESADEFELLFTQAFNDLAT
A0A8C5D4L1_BCL2L1-      TAGNGLQDRDGVIPPR-HGDDDVEAVKLALVESADEFELLFTQAFNDLAT
                        * .**  : . *   *  .  .::*** ** ::*:**** :: **.** :

A0A8C5G971_BCL2L1-      QLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMS
A0A8C5D4L1_BCL2L1-      QLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMS
A0A8C5D4L1_BCL2L1-      QLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMS
A0A8C5D4L1_BCL2L1-      QLQITPDTAYSSFKSVMDEVFKDGVNWGRIVGLFVFGGVLCLECSEKDMS
                        **:*** ***.**:.******.************.***.**:** **:**

A0A8C5G971_BCL2L1-      PLVGRIVEWMTVYLDNHIQPWIQSQ-GGWERFAEVFGQDAVAEIRRSEES
A0A8C5D4L1_BCL2L1-      ELVPRIADWMTMYLDENINEWIESEGGGWASFAQIFGQDAAAKARKARTS
A0A8C5D4L1_BCL2L1-      ELVPRIADWMTMYLDENINEWIESEGGGWRT--TLMGHIPHIAEHSAS--
A0A8C5D4L1_BCL2L1-      ELVPRIADWMTMYLDENINEWIESEGGGWASFAQIFGQDAAAKARKARTS
                         ** **.:***:***::*: **:*: ***     ::*: .    . :   

A0A8C5G971_BCL2L1-      FKKWLLVGMTVVTGVVVGSLFAQKRL------------------------
A0A8C5D4L1_BCL2L1-      MKRWFLFGAVVLTGVLFLVCYVKRREPHLWVTYLTLLNTAPLSYQEIFLL
A0A8C5D4L1_BCL2L1-      -----VIPGNISVGWM----------------------------------
A0A8C5D4L1_BCL2L1-      MKRWFLFGAVVLTGVLFLVCYVKRR-------------------------
                             :.   : .* :                                  

A0A8C5G971_BCL2L1-      -------------
A0A8C5D4L1_BCL2L1-      DGCNITSSSIPHS
A0A8C5D4L1_BCL2L1-      -------------
A0A8C5D4L1_BCL2L1-      -------------
                                     

© 1998-2022Legal notice