Dataset for protein Mcl-1 of organism Gallus gallus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=415 residues).
MGVGPASGSGAKRPLWPFFTPKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPARATRRRCSLGA
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRKWRS
>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=372 residues).
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRPGPHPRPPGMGHPQNEAAVTAARGLQVRNFFLTGDLNKWLF
>gnl|bcl2dbpro|A0A1L1RNM6_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=441 residues).
MHGVQQGTHHRFLERLRGRTPPQLPALSRRMGVGPASGSGAKRPLWPFFTPKFHFSPPRTPRARHDRSPLPSPRGGRTGS
GTAPPWRHRGHITVPALPARATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAE
VPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGT
PPELPDLIPDELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKALETLRRVGDGVMQKHELAFQ
GMLRKLEIKKEDDLQAVCEVAAHVFNDGVTNWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQ
GGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice