Dataset for protein Mcl-1 of organism Gallus gallus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8V1A8S6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=335 residues).
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPCRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRKWRS
>gnl|bcl2dbpro|A0A8V1A8S6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=331 residues).
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPCRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIR
>gnl|bcl2dbpro|A0A8V1A8S6_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gallus gallus GN=MCL-1 (length=372 residues).
MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAAPAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAA
PHAPIGSAAARRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPDELRQESLELILRYLREAAGE
AEPGVKKLFPGLLGGPGRPCRASSAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLESSIRNVLMAFAGVA
GLGASLAYMIRPGPHPRPPGMGHPQNEAAVTAPRGLQVRNFFLTGDLNKWLF
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice