Dataset for protein Mcl-1 of organism Gallus gallus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1L1RNM6_MCL1-02      --------------------------------------------------
A0A1L1RNM6_MCL1-01      ------------------------------MGVGPASGSGAKRPLWPFFT
A0A1L1RNM6_MCL1-03      MHGVQQGTHHRFLERLRGRTPPQLPALSRRMGVGPASGSGAKRPLWPFFT
                                                                          

A0A1L1RNM6_MCL1-02      --------------------------------------------------
A0A1L1RNM6_MCL1-01      PKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPAR
A0A1L1RNM6_MCL1-03      PKFHFSPPRTPRARHDRSPLPSPRGGRTGSGTAPPWRHRGHITVPALPAR
                                                                          

A0A1L1RNM6_MCL1-02      ----------MFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
A0A1L1RNM6_MCL1-01      ATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
A0A1L1RNM6_MCL1-03      ATRRRCSLGAMFAVKRNAVIGFNLYCGGGSPGLVPASPAGEQTPPPAAAA
                                  ****************************************

A0A1L1RNM6_MCL1-02      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
A0A1L1RNM6_MCL1-01      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
A0A1L1RNM6_MCL1-03      PAAAAATVAEVPRPLIGSAGLWAAAGRAEAPRAPIGSGAAPHAPIGSAAA
                        **************************************************

A0A1L1RNM6_MCL1-02      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
A0A1L1RNM6_MCL1-01      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
A0A1L1RNM6_MCL1-03      RRAPPDSTSRPVALWSPEEELDGCEPESERGPGGDSLPGTPPELPDLIPD
                        **************************************************

A0A1L1RNM6_MCL1-02      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
A0A1L1RNM6_MCL1-01      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
A0A1L1RNM6_MCL1-03      ELRQESLELILRYLREAAGEAEPGVKKLFPGLLGGPGRPGRASSAVMEKA
                        **************************************************

A0A1L1RNM6_MCL1-02      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
A0A1L1RNM6_MCL1-01      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
A0A1L1RNM6_MCL1-03      LETLRRVGDGVMQKHELAFQGMLRKLEIKKEDDLQAVCEVAAHVFNDGVT
                        **************************************************

A0A1L1RNM6_MCL1-02      NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQ
A0A1L1RNM6_MCL1-01      NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQ
A0A1L1RNM6_MCL1-03      NWGRVVTLISFGAFVAKHLKSINQEKCITSLAGIITDALVSSKREWLMSQ
                        **************************************************

A0A1L1RNM6_MCL1-02      GGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIRPGPHPRPPG
A0A1L1RNM6_MCL1-01      GGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR---------
A0A1L1RNM6_MCL1-03      GGWEGFVDFFRVEDLESSIRNVLMAFAGVAGLGASLAYMIR---------
                        *****************************************         

A0A1L1RNM6_MCL1-02      MGHPQNEAAVTAARGLQVRNFFLTGDLNKWLF
A0A1L1RNM6_MCL1-01      ----------------------------KWRS
A0A1L1RNM6_MCL1-03      --------------------------------
                                                        

© 1998-2022Legal notice