Dataset for protein Bcl-2 of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|M3X1R9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=237 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAA
GPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|M3X1R9_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=224 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAA
GPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWLILLPRTSYELKSSRALREDVRISPSFLFKD
>gnl|bcl2dbpro|Q8I008_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=235 residues).
MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAGP
ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2020Legal notice