Dataset for protein Bcl-2 of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F5Y6Y3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFS
A0A5F5Y6Y3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFS
Q8I008_BCL2-01          MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFS
                        *********************:*.**************************

A0A5F5Y6Y3_BCL2-02      SQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGD
A0A5F5Y6Y3_BCL2-01      SQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGD
Q8I008_BCL2-01          SQPGRTPAPARTSPPPPPVAP--AAAAAAAGPALSPVPPVVHLTLRQAGD
                        *********************  ***************************

A0A5F5Y6Y3_BCL2-02      DFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFE
A0A5F5Y6Y3_BCL2-01      DFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFE
Q8I008_BCL2-01          DFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFE
                        **************************************************

A0A5F5Y6Y3_BCL2-02      FGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWLILL---
A0A5F5Y6Y3_BCL2-01      FGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELY
Q8I008_BCL2-01          FGGVMCVEGVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELY
                        ********.**********************************  ::   

A0A5F5Y6Y3_BCL2-02      -----PRTSYELKSSRALREDVRISPSFLFKD-----
A0A5F5Y6Y3_BCL2-01      GPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q8I008_BCL2-01          GPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                             *  .:.  * .** . . :...: :       

© 1998-2022Legal notice