Dataset for protein BCL-2-like of organism Denticeps clupeoides

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4BCS5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Denticeps clupeoides GN=MCL-1 (length=257 residues).
MSLSAMKRPAGSVIGLLCSHFAVPCAVADNKGDPGDELDEADSFALKPERRDMGLDSGFQSSDDDASLPASPDGPPRTIL
DRDRDALELETRQLVGDFYRIYVGGKPADTRPHNALPTMRKVVDEVLRKHQISFKSMVQKLVLQSQNEKMAFVTAVAKNI
FKDGTTNWGRIASLVAFGAVVCRELKAIDREDCVETVTTQICTYLATEQREWFVNNSGWVGFVDFFHVEDPETVVWNTLI
AVAGFAGLGAGLALMIR
>gnl|bcl2dbpro|A0A8C4CMF6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Denticeps clupeoides GN=BCL2L1 (length=241 residues).
MSYSNRELVVYYINYKLSQRNYPLSHVGLTHQMESPVDSSQEGAGVTALSNGSVNGTSALPASAELSPLLSPVLSGNGSG
GGASSSSSIDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVEC
VEKEMSPLVARIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDTAAESRRSQESFKNWLVAGMTLVTGVVVGSLIVRKH
L
© 1998-2022Legal notice