Dataset for protein BCL-2-like of organism Denticeps clupeoides

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4BCS5_MCL1-01      MSLSAMKRPAGSVIGLLCSHFAVPCAVADNKGDPGDELDEADSFALKPER
A0A8C4CMF6_BCL2L1-      MSYSNRELVVYYINYKLSQR----------------------NYPLSHVG
                        ** *  :  .  :   *...                      .:.*.   

A0A8C4BCS5_MCL1-01      RDMGLDSGFQSSDDDASLPASPDGPPR--TILDRDRDALELETRQLVGDF
A0A8C4CMF6_BCL2L1-      LTHQMESPVDSSQEGAGVTALSNGSVNGTSALPASAELSPLLSPVLSGNG
                            ::* .:**::.*.:.* .:*. .  : *  . :   * :  * *: 

A0A8C4BCS5_MCL1-01      YRIYVGGKPADTRPHNALPTMRKVVDEVLRKHQISFKSMVQKLVLQSQNE
A0A8C4CMF6_BCL2L1-      SG---GGASSSSSIDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATA
                             ** .:.:    .  ::*. .:*.  .:. :*..: .:* : . . 

A0A8C4BCS5_MCL1-01      KMAFVTAVAKNIFKDGTTNWGRIASLVAFGAVVCRELKAIDREDCVETVT
A0A8C4CMF6_BCL2L1-      YQSF-ESVMDEVFRDG-VNWGRVVGLFAFGGALCVECVEKEMSPLVARIA
                          :*  :* .::*.** .****:..*.***..:* *    : .  *  ::

A0A8C4BCS5_MCL1-01      TQICTYLATEQREWFVNNSGWVGFVDFFHVE-------DPETVVWNTLIA
A0A8C4CMF6_BCL2L1-      DWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDTAAESRRSQESFKNWLVAG
                         .: .** .  . *: .:.**  *.::*  :       . *:. .. : .

A0A8C4BCS5_MCL1-01      VAGFAGLGAGLALMIR--
A0A8C4CMF6_BCL2L1-      MTLVTGVVVGSLIVRKHL
                        :: .:*: .*  :: .  

© 1998-2022Legal notice