Dataset for protein BCL-2-like of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|Q568V1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=243 residues).
MSFLAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLDGRFVSTTDGSLPTTPDPEELDYAELERDTRQL
LLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASL
VAFGAVVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSCHGFVEFFHQEDVESVVRHGLLALVGCAGIGAGLAF
LIR
>gnl|bcl2dbpro|Q568W5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=228 residues).
MFAGRNNDNGFWPCTGLQSKPLVIPELKAHNQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLIIFTGLPHSK
SGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRG
HSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGGVATLSAALAYWIR
>gnl|bcl2dbpro|Q8UWD6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=228 residues).
MFAGRNNDNGFWPCTGLQSKPLVIPELKAHNQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSK
SGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRG
HSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGSVATLSAALAYWIR
>gnl|bcl2dbpro|Q9I9N3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=255 residues).
MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYTEEEEAPLKRLRPGTNGLKGLQLDGRFVSATDGSLPTTPDPEEL
DYAELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFK
DGVTNWGRIASLVAFGAVVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGLLAL
VGCAGIGAGLAFLIR
© 1998-2022Legal notice