Dataset for protein BCL-2-like of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q568W5_MCL1-01      ---MFAGRNNDNGFWPCTGLQSKPLV---------------------------IPELKAH
Q8UWD6_MCL1-01      ---MFAGRNNDNGFWPCTGLQSKPLV---------------------------IPELKAH
Q568V1_MCL1-01      ------------MSFLAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLD
Q9I9N3_MCL1-01      MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYTEEEEAPLKRLRPGTNGLKGLQLD
                                  : . *:*: .*                            :  *:  

Q568W5_MCL1-01      NQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLIIFTGLPHSKSGRKQVLSTM
Q8UWD6_MCL1-01      NQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSKSGRKQVLSTM
Q568V1_MCL1-01      GRF-VSTTDGSLPTTPDPEELDY--AELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTM
Q9I9N3_MCL1-01      GRF-VSATDGSLPTTPDPEELDY--AELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTM
                    ..* *.: :**:*::*. *  **  : *: ***:::  *   .**:   .   ::.:.**

Q568W5_MCL1-01      RRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q8UWD6_MCL1-01      RRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGA
Q568V1_MCL1-01      KRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
Q9I9N3_MCL1-01      KRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASLVAFGA
                    .*****: ***::****** **:*:.:  .:.**. :*: :*.**.*********::***

Q568W5_MCL1-01      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
Q8UWD6_MCL1-01      MLCKYQNDRGHSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTL
Q568V1_MCL1-01      VVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSCHGFVEFFHQEDVESVVRHGL
Q9I9N3_MCL1-01      VVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGL
                    ::*.  ::  :.: *  *.*:***** :**.****.**:  *******  *.*:.**: *

Q568W5_MCL1-01      LTIGGVATLSAALAYWIR
Q8UWD6_MCL1-01      LTIGSVATLSAALAYWIR
Q568V1_MCL1-01      LALVGCAGIGAGLAFLIR
Q9I9N3_MCL1-01      LALVGCAGIGAGLAFLIR
                    *:: . * :.*.**: **

© 1998-2022Legal notice