Dataset for protein Bcl-xL of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C1JXA4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L1 (length=239 residues).
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTHRTDAVEGNDDEEAAGTTTLVNGSLNGTSTGSTGTPPRSPTSAPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIAHWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A8C2G339_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L1 (length=247 residues).
AIAPSLSVGRSLRRTQGCALCSKNKRVDIQTSENDEQRQDTHRTDAAEGNDDEEAAGRTTLVNGSLNGTSTGSTGTPPRS
PTSAPQRQTNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGG
ALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGS
LIAQKRL
>gnl|bcl2dbpro|A0A8C2HNY8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L1 (length=239 residues).
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEEAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSLQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIAEWMIVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFRKWLLAGITLLTGVVVGSLIAQKRL
© 1998-2022Legal notice