Dataset for protein Bcl-xL of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2G339_BCL2L1-      AIAPSLSVGRSLRRTQGCALCSKNKRVDIQTSEND-EQRQDTHRTDAAEG
A0A8C1JXA4_BCL2L1-      ---------MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTHRTDAVEG
A0A8C2HNY8_BCL2L1-      ---------MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEG
                                  *  . :  .:  * *  : : . *  *  :**:****.**

A0A8C2G339_BCL2L1-      NDDEEAAGRTTLVNGSLNGTSTGSTGTPPRSPTSAPQRQTNGTGGLDAVK
A0A8C1JXA4_BCL2L1-      NDDEEAAGTTTLVNGSLNGTSTGSTGTPPRSPTSAPQRQTNGTGGLDAVK
A0A8C2HNY8_BCL2L1-      NDDEEAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVK
                        ******** ***********************:*:***************

A0A8C2G339_BCL2L1-      EALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNW
A0A8C1JXA4_BCL2L1-      EALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNW
A0A8C2HNY8_BCL2L1-      EALRDSANEFELRYSQAFNDLSLQLHITPATAYQSFESVMDEVFRDGVNW
                        ********************** ***************************

A0A8C2G339_BCL2L1-      GRIVGLFAFGGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGG
A0A8C1JXA4_BCL2L1-      GRIVGLFAFGGALCVECVEKEMSPLVGSIAHWMTVYLDNKIQPWIQSQGG
A0A8C2HNY8_BCL2L1-      GRIVGLFAFGGALCVECVEKEMSPLVGSIAEWMIVYLDNKIQPWIQSQGG
                        ****************************** ** ****************

A0A8C2G339_BCL2L1-      WERFAEIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
A0A8C1JXA4_BCL2L1-      WERFAEIFGKDAAAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
A0A8C2HNY8_BCL2L1-      WERFAEIFGKDAAAESRKSQENFRKWLLAGITLLTGVVVGSLIAQKRL
                        ***********************.******:*****************

© 1998-2022Legal notice