Dataset for protein Bcl-xL of organism Cyclopterus lumpus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2ZH46_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL2L1 (length=225 residues).
MSNINRELVEFFISYKLSQKNYPTSLLWPEEDAAGGRTEGDEADPASSNGSLVNGGDGDGAGPSGTSSPPSGDVEAVKAA
LRDSANEFELLFTQAFSDLSSQLDVTPVTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGSVLCVDCVEKDMSELVSRIADW
MTTYLDEHISAWIQSQGGWDCFAEIFGRDSAAEARISQETLRRWLLVGAALLKGVLGGMAISKKR
>gnl|bcl2dbpro|A0A8C2ZZ68_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyclopterus lumpus GN=BCL2L1 (length=234 residues).
MSQNRELVVFYINYKLSQRNYPLTHMGLTEPLNRTDGGEAGAGDAEEQRVATHANGTFNGTSPGTPPASPLRPQRLPSTT
NLDAVKEALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSP
LVGRIIEWMTVYLDNHIQPWIQTQGGWERFAEIFGQDAAAESRKSQESFKKWLLAGVTLVTGVVVVLLIGQKRL
© 1998-2022Legal notice