Dataset for protein Bcl-xL of organism Cyclopterus lumpus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2ZH46_BCL2L1-      MSNINRELVEFFISYKLSQKNYPTSLLWPEEDAAGGRTEGDEADPASSNG
A0A8C2ZZ68_BCL2L1-      -MSQNRELVVFYINYKLSQRNYPLTHMGLTEPL--NRTDGGEAGAGDAEE
                          . ***** *:*.*****.*** : :   *    .**:*.**....:: 

A0A8C2ZH46_BCL2L1-      SLV---NGGDGDGAGPSGTSS--------PPSGDVEAVKAALRDSANEFE
A0A8C2ZZ68_BCL2L1-      QRVATHANGTFNGTSPGTPPASPLRPQRLPSTTNLDAVKEALRDSANEFE
                        . *    .*  :*:.*. ..:        *.: :::*** **********

A0A8C2ZH46_BCL2L1-      LLFTQAFSDLSSQLDVTPVTAYHSFKSVMDEVFKDGVNWGRVVGLFAFGS
A0A8C2ZZ68_BCL2L1-      LRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGG
                        * ::.***** .** :**.***:**:.******.*******:*******.

A0A8C2ZH46_BCL2L1-      VLCVDCVEKDMSELVSRIADWMTTYLDEHISAWIQSQGGWDCFAEIFGRD
A0A8C2ZZ68_BCL2L1-      ALCVECVEKEMSPLVGRIIEWMTVYLDNHIQPWIQTQGGWERFAEIFGQD
                        .***:****:** **.** :***.***:**..***:****: ******.*

A0A8C2ZH46_BCL2L1-      SAAEARISQETLRRWLLVGAALLKGVLGGMAISKKR-
A0A8C2ZZ68_BCL2L1-      AAAESRKSQESFKKWLLAGVTLVTGVVVVLLIGQKRL
                        :***:* ***::..***.*.:*:.**:  : *.:** 

© 1998-2022Legal notice