Dataset for protein Mcl-1 of organism Chrysemys picta bellii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3EZ48_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=MCL-1 (length=221 residues).
CAGGCSPSSPRPCPTPLLPPRPHLCPTPSPLHCCPASSRPVLPHPECTLPSLLPPSASYTLDHGRQEVGDGVIEKQQITF
QGMLRKLDIKHEEDLKSVTAVATHIFNDGVTNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVTGKRHWLVN
QRGWEGFVEFFRVEDLEGSSIRNVLVAFAGLGASLLRGFFFFFKSSGYKCSGLSLHCIMQQ
>gnl|bcl2dbpro|A0A8C3H9M3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=MCL-1 (length=198 residues).
MLALKRNAVIGLNLYCGGGPTLPPSPPGSPSGAGTPPTPGRLLSGPRGAGPAALEKALETLRRVGDGVMEKHQLAFQGML
RKLDIKNEEDLKSVTAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVTGKRDWLVNQRGW
EGFVEFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
© 1998-2022Legal notice