Dataset for protein Mcl-1 of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3EZ48_MCL1-01      ---------------CAGGCSPSSPRPCPTPLLPPRPHLCPTPSPLHCCP
A0A8C3H9M3_MCL1-01      MLALKRNAVIGLNLYCGGG-----------PTLPPSPPGSPSGA---GTP
                                       *.**           * *** *  .*: :     *

A0A8C3EZ48_MCL1-01      ASSRPVLPHPECTLPSLLPPSASYTLDHGRQEVGDGVIEKQQITFQGMLR
A0A8C3H9M3_MCL1-01      PTPGRLLSGPRGAGPAALEKALETL-----RRVGDGVMEKHQLAFQGMLR
                        .:.  :*. *  : *: *  : .       . *****:**:*::******

A0A8C3EZ48_MCL1-01      KLDIKHEEDLKSVTAVATHIFNDGVTNWGRIVTLISFGAFVAKHLKSINQ
A0A8C3H9M3_MCL1-01      KLDIKNEEDLKSVTAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQ
                        *****:*************:*.****************************

A0A8C3EZ48_MCL1-01      ENCINTLAGIITDVLVTGKRHWLVNQRGWEGFVEFFRVEDLEGSSIRNVL
A0A8C3H9M3_MCL1-01      ENCINTLAGIITDVLVTGKRDWLVNQRGWEGFVEFFRVEDLEG-SIRNVL
                        ******************** ********************** ******

A0A8C3EZ48_MCL1-01      VAFAGLGASLLRGFFFFFKSSGYKCSGLSLHCIMQQ
A0A8C3H9M3_MCL1-01      VAFA-----------------GFAGLGASLAYMMR-
                        ****                 *:   * **  :*. 

© 1998-2022Legal notice