Dataset for protein BCL-2-like of organism Chrysemys picta bellii

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C3EZ48_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=MCL-1 (length=221 residues).
CAGGCSPSSPRPCPTPLLPPRPHLCPTPSPLHCCPASSRPVLPHPECTLPSLLPPSASYTLDHGRQEVGDGVIEKQQITF
QGMLRKLDIKHEEDLKSVTAVATHIFNDGVTNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVTGKRHWLVN
QRGWEGFVEFFRVEDLEGSSIRNVLVAFAGLGASLLRGFFFFFKSSGYKCSGLSLHCIMQQ
>gnl|bcl2dbpro|A0A8C3FIW3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2A1 (length=175 residues).
MERSEYCYVYHLVQDYLKYILQEPQLGPAPSRVAHVLRNTASFLQKENEESLKPCLDTLDITTVDAARRIFTEVVDKEFA
DGNTNWGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISYFITEYIINNKAEWIEANGGWENGFLPMFEEKRSWLSLFNI
KAKIMDAFSFFSQYF
>gnl|bcl2dbpro|A0A8C3H9M3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=MCL-1 (length=198 residues).
MLALKRNAVIGLNLYCGGGPTLPPSPPGSPSGAGTPPTPGRLLSGPRGAGPAALEKALETLRRVGDGVMEKHQLAFQGML
RKLDIKNEEDLKSVTAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQENCINTLAGIITDVLVTGKRDWLVNQRGW
EGFVEFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
>gnl|bcl2dbpro|A0A8C3ITE1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL-2 (length=252 residues).
MYLIACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPTVAGTSSDHAGLVSL
PPEPPGSAAASNVPLGDGLRPAPQAVLLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRI
VAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLALVG
ACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=229 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3IUT0_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL2L1 (length=236 residues).
MSNTNRELVTDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIVSWMTTYLTDHLDPWIQENGGWERFVELYGNDAAAKSRKGQEQFNRSHLLSHCVSLQRPRPRLDAGCAQPRALG
© 1998-2022Legal notice