Dataset for protein BCL-2-like of organism Chrysemys picta bellii

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3FIW3_BCL2A1-      ---------------------MERSEYCYVYHLVQDYLKYILQE------
A0A8C3ITE1_BCL2-01      MYLIACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWA
A0A8C3IUT0_BCL2L1-      -------------------------MSNTNRELVTDFLSYKLSQRGYSWS
A0A8C3IUT0_BCL2L1-      -------------------------MSNTNRELVTDFLSYKLSQRGYSWS
A0A8C3IUT0_BCL2L1-      -------------------------MSNTNRELVTDFLSYKLSQRGYSWS
A0A8C3IUT0_BCL2L1-      -------------------------MSNTNRELVTDFLSYKLSQRGYSWS
A0A8C3EZ48_MCL1-01      --------------------------------------------------
A0A8C3H9M3_MCL1-01      -----------------------------------MLALKRNAVIGLNLY
                                                                          

A0A8C3FIW3_BCL2A1-      ---------------PQLGPAPS---------------------------
A0A8C3ITE1_BCL2-01      ANENRGPVSPNLSP-PTVAGTSSDHAGLVSLPPEPPGSAAASNVPLGDGL
A0A8C3IUT0_BCL2L1-      RFEGEDEIRTESAEEAEMASVPNGSPSWH------PGASHVVNGAAGHSN
A0A8C3IUT0_BCL2L1-      RFEGEDEIRTESAEEAEMASVPNGSPSWH------PGASHVVNGAAGHSN
A0A8C3IUT0_BCL2L1-      RFEGEDEIRTESAEEAEMASVPNGSPSWH------PGASHVVNGAAGHSN
A0A8C3IUT0_BCL2L1-      RFEGEDEIRTESAEEAEMASVPNGSPSWH------PGASHVVNGAAGHSN
A0A8C3EZ48_MCL1-01      CAGGCSPSSPRPCPTPLLPPRPHLCPTPSPLHCCPASSRPVLPHPECTLP
A0A8C3H9M3_MCL1-01      CGGG-----------PTLPPSPPGSPSGA---GTPPTPGRLLSGPRGAGP
                                       . :   .                            

A0A8C3FIW3_BCL2A1-      -----------RVAHVLRNTASFLQKENEESLKPCLDTLDITTVDAARRI
A0A8C3ITE1_BCL2-01      ------RPAPQAVLLTLCQAGDEFSRRYHRDFAQMSGQLHLTP-FTARGR
A0A8C3IUT0_BCL2L1-      SLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQS
A0A8C3IUT0_BCL2L1-      SLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQS
A0A8C3IUT0_BCL2L1-      SLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQS
A0A8C3IUT0_BCL2L1-      SLEAHERVPATGVRQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQS
A0A8C3EZ48_MCL1-01      SL--LPPSASYTLDHGRQEVGDGVIEKQQITFQGMLRKLDIKH-EEDLKS
A0A8C3H9M3_MCL1-01      AA--LEKALETL-----RRVGDGVMEKHQLAFQGMLRKLDIKN-EEDLKS
                                           ... .       :      * :.        

A0A8C3FIW3_BCL2A1-      FTEVVDKEFADGNTNWGRILTIFMFGGILSKRLQEHKVQLTGDNKEQISY
A0A8C3ITE1_BCL2-01      FVAVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPL---VDSIAV
A0A8C3IUT0_BCL2L1-      FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVL---VGRIVS
A0A8C3IUT0_BCL2L1-      FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVL---VGRIVS
A0A8C3IUT0_BCL2L1-      FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVL---VGRIVS
A0A8C3IUT0_BCL2L1-      FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVL---VGRIVS
A0A8C3EZ48_MCL1-01      VTAVATHIFNDGVTNWGRIVTLISFGAFVAKHLKSINQENC---INTLAG
A0A8C3H9M3_MCL1-01      VTAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQENC---INTLAG
                        .  *.   * **  *****:::: **. :.    . : .        :  

A0A8C3FIW3_BCL2A1-      FITEYIINNKAEWIEANGGWENGFLPMFE-------EKRSWLSLFN----
A0A8C3ITE1_BCL2-01      WMTEYLNRHLHNWIQDNGGWD-AFVELYG-------NNMRPLFDFS----
A0A8C3IUT0_BCL2L1-      WMTTYLTDHLDPWIQENGGWE-RFVELYGNDAAA--KSRKGQEQFN----
A0A8C3IUT0_BCL2L1-      WMTTYLTDHLDPWIQENGGWE-RFVELYGNDAAA--KSRKGQEQFN----
A0A8C3IUT0_BCL2L1-      WMTTYLTDHLDPWIQENGGWE-RFVELYGNDAAA--KSRKGQEQFN----
A0A8C3IUT0_BCL2L1-      WMTTYLTDHLDPWIQENGGWE-RFVELYGNDAAA--KSRKGQEQFN----
A0A8C3EZ48_MCL1-01      IITDVLVTGKRHWLVNQRGWE-GFVEFFRVEDLEGSSIRNVLVAFAGLGA
A0A8C3H9M3_MCL1-01      IITDVLVTGKRDWLVNQRGWE-GFVEFFRVEDLEG-SIRNVLVAFA----
                         :*  :      *:  : **:  *: ::        .       *     

A0A8C3FIW3_BCL2A1-      --------------------------IKAKIMDAFSFFSQYF
A0A8C3ITE1_BCL2-01      --------------WISLKTILSLALVGACITLGAYLGHK--
A0A8C3IUT0_BCL2L1-      -------------RWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      -------------RWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      -------------RWLLTGATLA-----GVLLLGSLLSRK--
A0A8C3IUT0_BCL2L1-      -------------RSHLLSHCVSLQRPRPRLDAGCAQPRALG
A0A8C3EZ48_MCL1-01      SLLRGFFFFFKSSGYKCSGLSLH------------CIMQQ--
A0A8C3H9M3_MCL1-01      -------------GFAGLGASLA------------YMMR---
                                                                  

© 1998-2022Legal notice