Dataset for protein BCL-2-like of organism Chinchilla lanigera

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8C2UN30_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2A1 (length=175 residues).
MIDQEFRYTQTLAQEYLLHVLQVPQCGASPSRTSRVLQGVAFSVQKEVEESLKPWLDRCDVASVNAARAIFTQVMEKEFE
DGIINWGRIVTIFAFGGVILKKLPREPLAPDVDTYREISHFVAEFVVNHTGDWIRQNGGWENGFVRKFEPKFGWLTFVGV
LGQICEMLSLLKQFY
>gnl|bcl2dbpro|A0A8C2VJ88_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L2 (length=169 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWPSAKLISRGKMGALIG
SWDSCARKE
>gnl|bcl2dbpro|A0A8C2VJ88_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C2VKS3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEESAAPPGAAPTPGIFSFQPGRNSPAAAPRDPAARTSPPPPLAGLAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice