Dataset for protein BCL-2-like of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2UN30_BCL2A1-      --MIDQEFRYTQTLAQEYLLHVLQVP--------QCGASPS---------
A0A8C2VJ88_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY------VCGAGPGEGPAAD---
A0A8C2VJ88_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY------VCGAGPGEGPAAD---
A0A8C2VKS3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW----DAGEESAAPPGAAPTP
A0A8C2YUU6_BCL2L1-      ------MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGA---
A0A8C2YUU6_BCL2L1-      ------MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGA---
A0A8C2YUU6_BCL2L1-      ------MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGA---
                                  .. :. .:: : *                           

A0A8C2UN30_BCL2A1-      ------------------------------------------------RT
A0A8C2VJ88_BCL2L2-      ------------------------------------------------PL
A0A8C2VJ88_BCL2L2-      ------------------------------------------------PL
A0A8C2VKS3_BCL2-01      GIFSFQPGRNSPAAAPRDPAARTSPPPPLAGLAAAAGP--ALSPVP-PVV
A0A8C2YUU6_BCL2L1-      -----ESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREVIPMAAV
A0A8C2YUU6_BCL2L1-      -----ESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREVIPMAAV
A0A8C2YUU6_BCL2L1-      -----ESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREVIPMAAV
                                                                          

A0A8C2UN30_BCL2A1-      SRVLQGVAFSVQKEVEESLKPWLDRCDVASVNAARAIFTQVMEKEFEDGI
A0A8C2VJ88_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG-
A0A8C2VJ88_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG-
A0A8C2VKS3_BCL2-01      HLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDG-
A0A8C2YUU6_BCL2L1-      KQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDG-
A0A8C2YUU6_BCL2L1-      KQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDG-
A0A8C2YUU6_BCL2L1-      KQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDG-
                          .:. .. ...      :     .  ::.  :*   *  * :: * .* 

A0A8C2UN30_BCL2A1-      INWGRIVTIFAFGGVILKKLPREPLAPDVDTYREISHFVAEFVVNHTGDW
A0A8C2VJ88_BCL2L2-      PNWGRLVAFFVFGAALCAESVNKEMEPLV---GQVQEWMVAYLETRLADW
A0A8C2VJ88_BCL2L2-      PNWGRLVAFFVFGAALCAESVNKEMEPLV---GQVQEWMVAYLETRLADW
A0A8C2VKS3_BCL2-01      VNWGRIVAFFEFGGVMCVESVNREMSPLV---DNIALWMTEYLNRHLHTW
A0A8C2YUU6_BCL2L1-      VNWGRIVAFFSFGGALCVESVDKEMQVLV---RRIASWMATYLNDHLEPW
A0A8C2YUU6_BCL2L1-      VNWGRIVAFFSFGGALCVESVDKEMQVLV---RRIASWMATYLNDHLEPW
A0A8C2YUU6_BCL2L1-      VNWGRIVAFFSFGGALCVESVDKEMQVLV---RRIASWMATYLNDHLEPW
                         ****:*::* **..:  :     :   *     :  ::. ::  .   *

A0A8C2UN30_BCL2A1-      IRQNGGWENGFVRKFEPKF------------------GWLTFVGVLGQIC
A0A8C2VJ88_BCL2L2-      IHSSGGWP-------------SAKLISRG--------K------------
A0A8C2VJ88_BCL2L2-      IHSSGGWAE-FTALYGDGALEEARRLREG--------NWASVRTVLTGAV
A0A8C2VKS3_BCL2-01      IQDNGGWDA-FVELYGPSV-------RPLFDFSWLSLKTLLSLALVGACI
A0A8C2YUU6_BCL2L1-      IQENGGWDT-FVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVV
A0A8C2YUU6_BCL2L1-      IQENGGWDT-FVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVV
A0A8C2YUU6_BCL2L1-      IQENGGWDT-FVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVV
                        *...***                                           

A0A8C2UN30_BCL2A1-      EMLSLLKQFY------
A0A8C2VJ88_BCL2L2-      -MGALIGSWDSCARKE
A0A8C2VJ88_BCL2L2-      ALGALVTVGAFFASK-
A0A8C2VKS3_BCL2-01      TLGAYLGHK-------
A0A8C2YUU6_BCL2L1-      LLGSLFSRK-------
A0A8C2YUU6_BCL2L1-      LLGSLFSRK-------
A0A8C2YUU6_BCL2L1-      LLGSLFSRK-------
                         : : .          

© 1998-2022Legal notice