Dataset for protein BCL-2-like of organism Chelydra serpentina

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C3RIU8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chelydra serpentina GN=BCL2L1 (length=229 residues).
MSNTNRELVIDFLSYKLSQRGYSWSRFEGEDEIRTESAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERVPAT
GVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIASWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3RME9_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chelydra serpentina GN=BCL2A1 (length=185 residues).
MESSEYRNVYYLVQDYLKYILQEPQLGPAPSRVAHVLRNAASFLQKENEESLKPCLDTLDITSVDAARRIFTQVMEKEFA
DGNTNWGRILTIFMFGGILSKRLQEHRVQLTGDNKEQISYFITEYIINNKAEWIEANGGWVSFSAVFYNHFSLLSRSEEF
SLINVLLTTVKKNHQLSQGFIICFI
>gnl|bcl2dbpro|A0A8C3SV21_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chelydra serpentina GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLNYIHYKLSQRGYDWAASENRGPVSPNLSPPTAAGTSSDPAGLVSLPPEPPGSAAASNVPLGDGL
HPAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C3T6A5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelydra serpentina GN=MCL-1 (length=331 residues).
MLALKRNAVIGLNLYCGGGPALAPPPPASPSGAGTPPAPGARDPGPSAEGARPATLIGGAAWASNGHSEGPRALIGEAPR
ARSSSPTTPPALVAGGPRPGPLWRPEEELDGCDPDAERMGPPAAAAGGSLPSTPPADDDDDLDGLYQDSLELISRYLREA
AELAGPGGKKLYKRLLSGPRGAGPAAMEKALETLRRVGDGVIEKHQIAFQGMLRKLDIKNKEDLKSVTAVATHVFSDGVT
NWGRIVTLISFGAFVAKHLKSINQETCINTLAGIITDVLVTDKRDWLVNQRGWEGFVEFFRVEDLEGSIRNVLVAFAGFA
GLGASLAYMMR
>gnl|bcl2dbpro|A0A8C3TAL3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelydra serpentina GN=MCL-1 (length=192 residues).
MLALKRNVVISLNLYCGGGPSLAPSPNGVGTPPAPRLLSGPRGAGPAAMETALEMLRRVGNGVIEKHQIAFQGMVRKLDI
KNEEDLKSVTAVATHVFSDGVAWGRIVTLISFGAFVAKHLKSINQETCINTLAGIITDVIVPGKRDWLVNQRGWEGFVEF
FRGEDLEGSIRNVLVAFAGFAGLEASLACMMQ
© 1998-2022Legal notice