Dataset for protein BCL-2-like of organism Chelydra serpentina

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3T6A5_MCL1-01      ------MLALKRNA---VIGLNLYCGGG---------------PALAPPP
A0A8C3RIU8_BCL2L1-      ------MSNTNREL---VIDFLSYKLSQRGYSWSRFEGEDEIRTE-----
A0A8C3SV21_BCL2-01      MAHPGRRGYDNREI---VLNYIHYKLSQRGYDWAASENRGPVSPNLSPPT
A0A8C3RME9_BCL2A1-      -----MESSEYRNVYYLVQDYLKYILQE---------------PQLGPAP
A0A8C3TAL3_MCL1-01      ------MLALKRNV---VISLNLYCGGG---------------PSLAPSP
                                   *:    * .   *                   .      

A0A8C3T6A5_MCL1-01      PASPSGAGTPPAPGARDPGPSAEGARPATLIGGAAWASNGHSEGPRALIG
A0A8C3RIU8_BCL2L1-      ----SAEEAEMASVPNGSPSWHPGASHIVNGAAGHSNSLEAHERV-----
A0A8C3SV21_BCL2-01      AAGTSSDPAGLVSLPPEPPG----------SAAASNVPLGDGLHP-----
A0A8C3RME9_BCL2A1-      SRVA----------------------------------------------
A0A8C3TAL3_MCL1-01      NGVGTPPAPRLLSGPRGAGP------------------------A-----
                                                                          

A0A8C3T6A5_MCL1-01      EAPRARSSSPTTPPALVAGGPRPGPLWRPEEELDGCDPDAERMGPPAAAA
A0A8C3RIU8_BCL2L1-      --------------------------------------------------
A0A8C3SV21_BCL2-01      --------------------------------------------------
A0A8C3RME9_BCL2A1-      --------------------------------------------------
A0A8C3TAL3_MCL1-01      --------------------------------------------------
                                                                          

A0A8C3T6A5_MCL1-01      GGSLPSTPPADDDDDLDGLYQDSLELISRYLREAAELAGPGGKKLYKRLL
A0A8C3RIU8_BCL2L1-      --------------------------------------------------
A0A8C3SV21_BCL2-01      --------------------------------------------------
A0A8C3RME9_BCL2A1-      --------------------------------------------------
A0A8C3TAL3_MCL1-01      --------------------------------------------------
                                                                          

A0A8C3T6A5_MCL1-01      SGPRGAGPAAMEKALETLRRVGDGVIEKHQIAFQGMLRKLDIKNKEDLKS
A0A8C3RIU8_BCL2L1-      ---------PATGVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS
A0A8C3SV21_BCL2-01      ---------APQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGR
A0A8C3RME9_BCL2A1-      ---------------HVLRNAASFLQKENEESLKPCLDTLDITSVDAARR
A0A8C3TAL3_MCL1-01      ---------AMETALEMLRRVGNGVIEKHQIAFQGMVRKLDIKNEEDLKS
                                         *  ... .       :      * :.       

A0A8C3T6A5_MCL1-01      V-TAVATHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQETCINT---LA
A0A8C3RIU8_BCL2L1-      F-EQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVGR---IA
A0A8C3SV21_BCL2-01      F-VAVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDS---IA
A0A8C3RME9_BCL2A1-      IFTQVMEKEFADGNTNWGRILTIFMFGGILSKRLQEHRVQLTGDNKEQIS
A0A8C3TAL3_MCL1-01      V-TAVATHVFSDG-VAWGRIVTLISFGAFVAKHLKSINQETCINT---LA
                        .   *    * ** . ****:::: **. :.    .   .   .    ::

A0A8C3T6A5_MCL1-01      GIITDVLVTDKRDWLVNQRGWEGFVEFFR----------VEDLE---GSI
A0A8C3RIU8_BCL2L1-      SWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQEQFN------
A0A8C3SV21_BCL2-01      VWMTEYLNRHLHNWIQDNGGWDAFVELYGNNM-------RPLFDFSWISL
A0A8C3RME9_BCL2A1-      YFITEYIINNKAEWIEANGGWVSFSAVFYNHFSLLSR--SEEF----SLI
A0A8C3TAL3_MCL1-01      GIITDVIVPGKRDWLVNQRGWEGFVEFF--------R--GEDLE---GSI
                          :*  :      *:  : **  *  .:              :       

A0A8C3T6A5_MCL1-01      RNVLVAFAGFAGLGASLAYMMR
A0A8C3RIU8_BCL2L1-      RWLLTGATLAGVLLLGSLLSRK
A0A8C3SV21_BCL2-01      KTILSLALVGACITLGAYLGHK
A0A8C3RME9_BCL2A1-      NVLLTTVKKNHQLSQGFIICFI
A0A8C3TAL3_MCL1-01      RNVLVAFAGFAGLEASLACMMQ
                        . :*        :  .      

© 1998-2022Legal notice