Dataset for protein BCL-2-like of organism Catharus ustulatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3TNF2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Catharus ustulatus GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSAPAAAAVAAAAGTSSDHTGLVSPHPEPPGSAAASHA
PLAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C3U3Q2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L1 (length=231 residues).
MYSSNRALVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGASVHQSSLEAHEIRRA
PDDVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVL
VKRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3U920_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKSEWIGANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
>gnl|bcl2dbpro|A0A8C3UEV5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Catharus ustulatus GN=MCL-1 (length=194 residues).
MLGAAEPRAKLAEPGEGTHVAAGMGMGMGTLFPGLLGGPDRPGAAGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLE
IQQEEDLQSVVEVAAHLFSDGVTNWGRVVTLIAFGAFVAKHLKSIKQEQSISSLAGIITDALVSSKRQWLESQGGWDGFV
DFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2023Legal notice