Dataset for protein BCL-2-like of organism Catharus ustulatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3TNF2_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSAPAAAA
A0A8C3U3Q2_BCL2L1-      ------MYSSNRALVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEM
A0A8C3U920_BCL2A1-      ---------------------------------METAEFYYVYYLAQDYL
A0A8C3UEV5_MCL1-01      ----------------------MLGAAEPRAKLAEPGEGTHVAAGMGMGM
                                                          :               

A0A8C3TNF2_BCL2-01      VAAAAGTSSDHTGLVSPHPEPPGSAAASHAPL-AEGLRPAPQVVHLVLRQ
A0A8C3U3Q2_BCL2L1-      DGVLNGSPSWH----APTSHIVNGASVHQSSLEAHEIRRAPDDVRQALRE
A0A8C3U920_BCL2A1-      QYVLQESHL------GPAQ---------TRVA-------------HVLRT
A0A8C3UEV5_MCL1-01      GTLFPGLLG------GPDRPGAAGDAVMEKAL-------------ETLRR
                                       .*                             .** 

A0A8C3TNF2_BCL2-01      AGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVA-VVEELFRDGV-NWGRI
A0A8C3U3Q2_BCL2L1-      AGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQ-VVNELFRDGV-NWGRI
A0A8C3U920_BCL2A1-      MASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFADGNTNWGRI
A0A8C3UEV5_MCL1-01      VGDGVMQKHELAFQGMLRKLEIQQEEDLQSVVE-VAAHLFSDGVTNWGRV
                         .. .  .    :  :  .: :      . .   *    * **  ****:

A0A8C3TNF2_BCL2-01      VAFFEFGGVMCVESV------NREMSPLVDSIAAWMTEYLNRHLHNWIQD
A0A8C3U3Q2_BCL2L1-      VAFFSFGGALCVESV------VKEMRVLVKRIVSWMTTYLTDHLDPWIQE
A0A8C3U920_BCL2A1-      MTIFTFGGLLTKKLQEHGVQLTAEEKEEISYF---ITEYIINNKSEWIGA
A0A8C3UEV5_MCL1-01      VTLIAFGAFVAKHLK------SIKQEQSISSLAGIITDALVSSKRQWLES
                        :::: **. :             :    :. :   :*  :      *:  

A0A8C3TNF2_BCL2-01      NGGWD-AFVELYGNSM-------RPLFDFSWISLKTILSLVLVGACITLG
A0A8C3U3Q2_BCL2L1-      NGGWE-RFVDLYGNDAAAEVRKGQETFN------KWLLTGATVAGVLLLG
A0A8C3U920_BCL2A1-      NGGWENGFLTKFE--------R------------RSLLSFSKITALFIAV
A0A8C3UEV5_MCL1-01      QGGWD-GFVDFFRVEDLEGSIR------------NVLMAFAGVAGLGASL
                        :***:  *:  :                      . :::   : .     

A0A8C3TNF2_BCL2-01      AYLGHK--
A0A8C3U3Q2_BCL2L1-      SLLSRK--
A0A8C3U920_BCL2A1-      VSLFREYY
A0A8C3UEV5_MCL1-01      AYMIR---
                          : .   

© 1998-2023Legal notice