Dataset for protein BCL-2-like of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

24 sequence(s)

>gnl|bcl2dbpro|A0A076FU27_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDARAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A076FZV9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452E1B1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSSVVNGATGHSRSLDAGKM
IPTAVVKQALREASNECELRYQQTFSDLTSQLHITPGTTYQSFEQVINELFQDGVNWCRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNNHLEPWIQENGDWDIFVELYENNTATESQKGQEHFNRWSLTDVTVAGMALLGLLFNT
>gnl|bcl2dbpro|A0A452ECF0_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A452EK63_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Capra hircus GN=BCL2A1 (length=175 residues).
MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIRQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A452EV13_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRAPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452FHY1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGGSGLSRKAAVSKDTPWLTFPSPHAQAY
>gnl|bcl2dbpro|A0A452FHY1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=240 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGLALQLIVTVPFITVIHVLHKLVFPSFCYSYRDLTI
>gnl|bcl2dbpro|A0A452FWV3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A452GA25_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSL
PSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A452GA25_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=335 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRL
LFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEEEEDELY
RQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
DGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAF
AGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C2N853_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=354 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSL
PSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAVNTRLYTEPADVIVCNLV
>gnl|bcl2dbpro|A0A8C2N853_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSL
PSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGXXXXXR
>gnl|bcl2dbpro|A0A8C2N853_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGXXXXXR
>gnl|bcl2dbpro|A0A8C2NR03_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=249 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWVRIVCIKGEDGLLQVCLLDCGGCPRTGVPHLYSHXXXXXXXXXXXXXXXXXX
XXXXXXLVK
>gnl|bcl2dbpro|A0A8C2NR03_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=219 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQEPTATHTSQGWA
>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=212 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLSATQK
>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-03 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=208 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A8C2PEQ8_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Capra hircus GN=BCL2L10 (length=242 residues).
MREGAGRRQAHKTGRGRPPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARVLEANRNVLPL
YRRYRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRLLVALLCAQFCEKHRA
WLMANGGWDGFCLSFSHSLQPSWERHLVWFFLSYWTAIIIIYFWIKLSNGFIVSESSLEDLEKGIKVLTCLDLWNQVTEK
SC
>gnl|bcl2dbpro|A0A8C2R4Z3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=374 residues).
LTDRLPLPGFENLAQFPALGGGVLFDCQVISPNGALAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGA
PGNQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRP
GISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A8C2R4Z3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=363 residues).
MGWPNLKYLPLGLSPYIHASFLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGA
TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A8C2R4Z3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=372 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSI
YVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGI
STTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A8C2R4Z3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=361 residues).
MGWPNLKYLPLGLSPYIHASFLCLTPTAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYL
ETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGA
TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL
>gnl|bcl2dbpro|A0A8C2RKE2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Capra hircus GN=BCL2A1 (length=206 residues).
MFRQAPQACASDCLGHLQVSRLKTLLPSKEKMTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVE
RTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITEN
TGEWIRQNGGWENGFVKKFETKSGWLTFLEVTGKICETLCRLKQYY
© 1998-2022Legal notice