Dataset for protein BCL-2-like of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
             . :                                                                
  aegtdvsatpv k afaptr vfr-e-f-s-ifdaveenee t--rtpipm-trs---g-a-----h---t------t
   mmpptefpy  a  e  vk   q - -  p    m      adegekddlen n iral lmvged nns  sd sl
    a  a  d      a   g   f                   p cde    k    s        a sva       

       170       180       190       200       210       220       230       240
                                                       . .  .      .  :      .  
r-tgapqeepe                             kvgatppkll--m r qngcqttletalqgflv- -vsve
eesd rkvpet                              e kaadpakeva s        fk c dk da   t  d
  l  ieq  s                              a       qd   a                a        
     gcm  m                                                                     

       250       260       270       280       290       300       310       320
     :  *    * .*  ** . *::: * . :                  :   :.  :      ** .. .*    .
ddrgrlat vyhv wg vt  dht tlie ravvamklksrnqspdmdcidsvmlsiatvivdskhd  vdqrd eagst
stvki sr svke s  ip  c n  i v e fmtkh ldiries   mcepltefvvsq ttrtra  rks   ag   
  qt   in   q        l    a   ii a  iv   a      kr sy   df enn ge  h    n   
        d   e                                   gd q      e  a        i   

       330       340       350       360       370       380       390    
akchvedleggrrlr h  c f  gm       larqlivt  vpfitvrtlrnvlv lpslvgyksg--yl  
   gtka a a             d          lkaa s  tn a flhittki  cet-hrqaq-ysti  
    dg                                     sg    ie  hg      pfc  lrdns   
                                           g         g       mca   f lr   
© 1998-2022Legal notice