Dataset for protein BCL-2-like of organism Calidris pygmaea

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C3JHE5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Calidris pygmaea GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDPAPLPPGLSPPAAAAAAAAAGTSSDHTGLVSPHPEPPGSAAASHV
PPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C3K1C5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Calidris pygmaea GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDKIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIMNNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AMFLAVFSLFREYY
>gnl|bcl2dbpro|A0A8C3KQJ2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Calidris pygmaea GN=BCL2L1 (length=230 residues).
MSNSNRELVIDFVSYKLSQKGYSWSDLQEEDENRTDFVAEEDEMDGVLNGSPSWHQPASHVVNGATVHRRSLEVHEIVQT
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVSWMTTYLTDHLDPWIRENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
© 1998-2022Legal notice