Dataset for protein BCL-2-like of organism Calidris pygmaea

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3K1C5_BCL2A1-      -----------METAEFYYVYYLAQD------------------------
A0A8C3JHE5_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDPAPLPPGLSPPAAAA
A0A8C3KQJ2_BCL2L1-      ------MSNSNRELVIDFVSYKLSQKGYSWSDLQEEDENRTDFVAEEDEM
                                    * .  :  * *:*                         

A0A8C3K1C5_BCL2A1-      -------------------------YLQYVLQESHLGPAQTRVA------
A0A8C3JHE5_BCL2-01      AAAAAGTSSDHTGLVSPHPEPPGSAAASHVPPAEGLRPAPQVVH------
A0A8C3KQJ2_BCL2L1-      DGVLNGSPSWHQ-------------PASHVVNGATVHRRSLEVHEIVQTA
                                                   .:*     :      *       

A0A8C3K1C5_BCL2A1-      ---HVLRNIASSLQDQTEEALRPFLDKIDITSVAVAKRIFNGVMEEKFAD
A0A8C3JHE5_BCL2-01      ---LTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGR-FVAVVEELFRD
A0A8C3KQJ2_BCL2L1-      DVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFRD
                            .**: ...:. .    :  : .:: :*. :.    *  *::* * *

A0A8C3K1C5_BCL2A1-      GNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIMNNKA
A0A8C3JHE5_BCL2-01      G-VNWGRIVAFFEFGGVMCVESVNREMSPL---VDSIAAWMTEYLNRHLH
A0A8C3KQJ2_BCL2L1-      G-VNWGRIVAFFSFGGALCVESVDKEMRVL---VGRIVSWMTTYLTDHLD
                        * .*****:::* *** :  :  :. :         *  ::* *:  :  

A0A8C3K1C5_BCL2A1-      EWIDANGGWENGFLTKFER--------------------RSLLSFSKITA
A0A8C3JHE5_BCL2-01      NWIQDNGGWDA-FVELYGNSM-------RPLFDFSWISLKTILSLVLVGA
A0A8C3KQJ2_BCL2L1-      PWIRENGGWER-FVDLYGNDAAAEVRKGQETFN------KWLLTGATVAG
                         **  ****:  *:  : .                    . :*:   : .

A0A8C3K1C5_BCL2A1-      MFLAVFSLFREYY
A0A8C3JHE5_BCL2-01      CITLGAYLGHK--
A0A8C3KQJ2_BCL2L1-      VLLLGSLLSRK--
                         :     * .:  

© 1998-2022Legal notice