Dataset for protein Bcl2l10 of organism Bos mutus grunniens

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9Y853_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L10 (length=232 residues).
MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL
YRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHR
AWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAIIIIYFWIKLSFLHIGPVFLPDVFQLFDLRHHWE
>gnl|bcl2dbpro|A0A8B9Y853_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L10 (length=232 residues).
MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPL
YRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHR
AWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAIIIIYFWIKLSANMDPAKLVSSQGNNICVDKKPA
© 1998-2022Legal notice