Dataset for protein Bcl2l10 of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9Y853_BCL2L10      MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGT
A0A8B9Y853_BCL2L10      MREGAGRRQAQKTGRGRTPGRGGAMVDPFRERTARLLMDYLEFCAREPGT
                        **************************************************

A0A8B9Y853_BCL2L10      PAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLL
A0A8B9Y853_BCL2L10      PAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLL
                        **************************************************

A0A8B9Y853_BCL2L10      DEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVAL
A0A8B9Y853_BCL2L10      DEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVAL
                        **************************************************

A0A8B9Y853_BCL2L10      LCAQFCERHRAWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAII
A0A8B9Y853_BCL2L10      LCAQFCERHRAWLMANGGWDGFCLFFSHSFQPSWERQLVWFFLSYWTAII
                        **************************************************

A0A8B9Y853_BCL2L10      IIYFWIKLSFLHIGPVFLPDVFQLFDLRHHWE
A0A8B9Y853_BCL2L10      IIYFWIKLSANMDPAKLVSSQGNNICVDKKPA
                        *********     . ::..  : : : ::  

© 1998-2022Legal notice