Dataset for protein Bcl-xL of organism Bos mutus grunniens

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9WB42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=236 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDAQKTIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSMATYL
NNHVKPWIQENGGWDTFVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A8B9X9C2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=217 residues).
KFILQGKGYSNRRLVVDFLSYKLSQKGYSWSRFNDVEENRTEASEGTKSDMETPMPSMTTHLATGHSRSLDAWKVIPVTT
EKQALREAGNDDQTSQLHITPGTAYQSFEQMMYELLQDGVNWGRIVAFFSFSGALCMESIDKETQVLVSQSTTWMATYLN
DHLESWIQENGGWDTSVKLCENNTTTESQKGQERFNSWSLTGMTSAGTALLGLLLNS
>gnl|bcl2dbpro|A0A8B9XQH5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice