Dataset for protein Bcl-xL of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9X9C2_BCL2L1-      KFILQGKGYSNRRLVVDFLSYKLSQKGYSWSRFNDVEENRTEASEGTKSD
A0A8B9WB42_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS--------------VR
A0A8B9XQH5_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESD
                               . *** ******************.*.                

A0A8B9X9C2_BCL2L1-      METP-----------MPSMTTHLATGHSRSLDAWKVIPVTTEKQALREAG
A0A8B9WB42_BCL2L1-      YGNPQWISGNPSWHLADSPTVNGATGHSRSLDAQKTIPMTTVKQALREAS
A0A8B9XQH5_BCL2L1-      METPSAINGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAG
                          .*             * :.: ******* **.:.**::: *******.

A0A8B9X9C2_BCL2L1-      ND----------DQTSQLHITPGTAYQSFEQMMYELLQDGVNWGRIVAFF
A0A8B9WB42_BCL2L1-      NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFF
A0A8B9XQH5_BCL2L1-      DEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFF
                        ::          *  ***.****** *****:: **:.* *:**.:****

A0A8B9X9C2_BCL2L1-      SFSGALCMESIDKETQVLVSQSTTWMATYLNDHLESWIQENGGWDTSVKL
A0A8B9WB42_BCL2L1-      SFSGTLCMKSIDKEIHVLVSQVTTSMATYLNNHVKPWIQENGGWDTFVEL
A0A8B9XQH5_BCL2L1-      SFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVEL
                        **.*:**::*:*** :****. :* ******:*::.********** *:*

A0A8B9X9C2_BCL2L1-      CENNTTTESQKGQERFNSWSLTGMT--SAGTALLGLLLNS----------
A0A8B9WB42_BCL2L1-      YESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVG
A0A8B9XQH5_BCL2L1-      YGNNAAAESRKGQERFNRWFLTGMT--VAGVVLLGSLFSRK---------
                          .*:: **.*******    *. .   *.      * .           

A0A8B9X9C2_BCL2L1-      ------
A0A8B9WB42_BCL2L1-      HSGSDR
A0A8B9XQH5_BCL2L1-      ------
                              

© 1998-2022Legal notice