Dataset for protein BCL-2-like of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A803T0A4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=355 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIH
LEAVTLVFLNFQVQAVFVRHGFLGSERGKQQHNCV
>gnl|bcl2dbpro|A0A803T0A4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=345 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWEGFVQFFHVEDIE
GGIRNVLVAFASVAGIGAGLAYMIR
>gnl|bcl2dbpro|A0A803T0A4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anolis carolinensis GN=MCL-1 (length=355 residues).
MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEG
SQRALIGCDAEGEGEQPKWRPASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTL
EVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAEVARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLAS
VAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIH
LEAVTLVFLNFQVQAVFVRHGFLGSERGKQQHTCP
>gnl|bcl2dbpro|H9GHK7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L1 (length=229 residues).
MSSSNRALVVDFLSYKLSQRGHSWHEIEMESGEEAMEPANETGNTLNGSPSWHPSPSHVINGASEHPELLEEEEEENPRV
DVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMQGLVV
RIASWMTTYLTEHLDPWIQENGGWERFVDVYGNDAAAKSRKGQERFNKWLWTGATVAGVVLLGSLLSRK
>gnl|bcl2dbpro|H9GPE7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anolis carolinensis GN=BCL-2 (length=245 residues).
MAHPGIRGYDNREIVLRYIHYKLSQKGYDWVASGDRGNLAAAAAAAAATPSAPTVSASLSPELLNSDPVSTNAPREEPDP
VPQVVHTTLRQAGDEFSRRYRRDFAQMSGQLHLTPSTARSRFVAVVEELFQDGVNWGRIVAFFEFGGMLCVESVSREMSP
LVDNIATWMTEYLNQYLRNWIQENGGWVCGSLSLSFSVSRSYITETSIPVSQMACVTSGSQCGVTCKVVPRAFCLFRTKG
DNQLL
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice