Dataset for protein BCL-2-like of organism Anolis carolinensis

[Download (right click)] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A803T0A4_MCL1-02      MF------NKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGG
A0A803T0A4_MCL1-03      MF------NKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGG
H9GPE7_BCL2-01          MAHPGIRGYDNREIVLR---------------------------------
H9GHK7_BCL2L1-01        MS------SSNRALVVD---------------------------------
A0A803T0A4_MCL1-01      MF------NKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGG
                        *        .:  :::                                  

A0A803T0A4_MCL1-02      VSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGE-
A0A803T0A4_MCL1-03      VSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGE-
H9GPE7_BCL2-01          ----YIH--------------------------YKLSQKGYDWVA-----
H9GHK7_BCL2L1-01        ----FLS--------------------------YKLSQRGHSWHEIEMES
A0A803T0A4_MCL1-01      VSVPKASGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGE-
                                                         :: **:.          

A0A803T0A4_MCL1-02      --------G-------EQPKWRPASLPLPEGELDGCEEAEEEEAATVPSS
A0A803T0A4_MCL1-03      --------G-------EQPKWRPASLPLPEGELDGCEEAEEEEAATVPSS
H9GPE7_BCL2-01          -------SGDRGNLAAAAAAAAATPSAPTVSASLSPELLNSD-----PVS
H9GHK7_BCL2L1-01        GEEAMEPANETGNTLNGSPSWHPSPSHVINGASEHPELLEEE--------
A0A803T0A4_MCL1-01      --------G-------EQPKWRPASLPLPEGELDGCEEAEEEEAATVPSS
                                .         .   .:.     .     *  :.:        

A0A803T0A4_MCL1-02      TPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGSKG
A0A803T0A4_MCL1-03      TPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGSKG
H9GPE7_BCL2-01          TNAPRE-------E------------------------------------
H9GHK7_BCL2L1-01        -----E-------E------------------------------------
A0A803T0A4_MCL1-01      TPSPDKEMAEEEGEKGKGGPPLFPDHLRKTTLEVVGRYLREAADEAGSKG
                             :       *                                    

A0A803T0A4_MCL1-02      TGPKFSFQGLLGRFGSSPNEAEVAR-ALETLRRVGESLREKHLLAFQGML
A0A803T0A4_MCL1-03      TGPKFSFQGLLGRFGSSPNEAEVAR-ALETLRRVGESLREKHLLAFQGML
H9GPE7_BCL2-01          -------------------PDPVPQVVHTTLRQAGDEFSRRYRRDFAQMS
H9GHK7_BCL2L1-01        -------------------ENPRVD-VSQTLREAGDEFELRYRRAFSDLT
A0A803T0A4_MCL1-01      TGPKFSFQGLLGRFGSSPNEAEVAR-ALETLRRVGESLREKHLLAFQGML
                                                  .  ***..*:.:  ::   *  : 

A0A803T0A4_MCL1-02      RKLEIKKEEDLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSIN
A0A803T0A4_MCL1-03      RKLEIKKEEDLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSIN
H9GPE7_BCL2-01          GQLHLTPSTARSRFVAVVEELFQDGV-NWGRIVAFFEFGGMLCVESVSRE
H9GHK7_BCL2L1-01        SQLHITLGTAYQSFEQVVNELFHDGV-NWGRIVAFFSFGGALCVESVDKE
A0A803T0A4_MCL1-01      RKLEIKKEEDLASVAEVTTEVFRDGIINWGRIVTLISFGAFVAKHLKSIN
                         :*.:.       .  *. *:*:**: ******:::.**. :. .  . :

A0A803T0A4_MCL1-02      QENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIHLEAVTLV
A0A803T0A4_MCL1-03      QENAINTLIEIITDVLVTDKREWLLKHNAWEGF-----VQFFHVEDIEGG
H9GPE7_BCL2-01          MSPLVDNIATWMTEYLNQYLRNWIQENGGW--------------------
H9GHK7_BCL2L1-01        MQGLVVRIASWMTTYLTEHLDPWIQENGGWERF-----VDVYGND-AAAK
A0A803T0A4_MCL1-01      QENAINTLIEIITDVLVTDKREWLLKHNAWQRARLGSATLRIHLEAVTLV
                         .  :  :   :*  *      *: ::..*                    

A0A803T0A4_MCL1-02      FL-------NFQVQAVFVRHGFLGSE------------------------
A0A803T0A4_MCL1-03      IR-------N-----VLVAFASVAGI------------------------
H9GPE7_BCL2-01          ----------------------VCGSLSLSFSVSRSYITETSIPVSQMAC
H9GHK7_BCL2L1-01        SRKGQERFNK-----WLWTGATVAGVVLLGSLLSRK--------------
A0A803T0A4_MCL1-01      FL-------NFQVQAVFVRHGFLGSE------------------------
                                              : .                         

A0A803T0A4_MCL1-02      ---------------------RGKQQHTCP
A0A803T0A4_MCL1-03      ---------------------GAGLAYMIR
H9GPE7_BCL2-01          VTSGSQCGVTCKVVPRAFCLFRTKGDNQLL
H9GHK7_BCL2L1-01        ------------------------------
A0A803T0A4_MCL1-01      ---------------------RGKQQHNCV
                                                      

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice