Dataset for protein BCL-2-like of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803T0A4_MCL1-02      MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKA
A0A803T0A4_MCL1-01      MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKA
A0A803T0A4_MCL1-03      MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKA
H9GHK7_BCL2L1-01        --------------------------------------------------
H9GPE7_BCL2-01          --------------------------------------------------
                                                                          

A0A803T0A4_MCL1-02      SGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWR
A0A803T0A4_MCL1-01      SGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWR
A0A803T0A4_MCL1-03      SGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWR
H9GHK7_BCL2L1-01        ----------------MSSSNRALVVDFLSYKLSQRGHS---------WH
H9GPE7_BCL2-01          ----------MAHPGIRGYDNREIVLRYIHYKLSQKGYD---------WV
                                         .   * ::  :   : :  * .         * 

A0A803T0A4_MCL1-02      PASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPL
A0A803T0A4_MCL1-01      PASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPL
A0A803T0A4_MCL1-03      PASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPL
H9GHK7_BCL2L1-01        EIEMESGEEAMEPANETGNTLNGS-PSWHPSPSHVIN---------GASE
H9GPE7_BCL2-01          ------------ASGDRGNLAAAA-AAAAATPSAPTV---------SASL
                                     . :  :   .: .:  .:*.             ... 

A0A803T0A4_MCL1-02      FPDHLRKTTLEVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAE
A0A803T0A4_MCL1-01      FPDHLRKTTLEVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAE
A0A803T0A4_MCL1-03      FPDHLRKTTLEVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAE
H9GHK7_BCL2L1-01        HPELLE-------------------------------------EEEEENP
H9GPE7_BCL2-01          SPELLNSDPVSTNAP---------------------------REEPDPVP
                         *: *                                      .. :   

A0A803T0A4_MCL1-02      VARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFR
A0A803T0A4_MCL1-01      VARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFR
A0A803T0A4_MCL1-03      VARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFR
H9GHK7_BCL2L1-01        RVDVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFH
H9GPE7_BCL2-01          QV-VHTTLRQAGDEFSRRYRRDFAQMSGQLHLTPSTARSRFVAVVEELFQ
                         . .  *** .*:.:  .:   *  :  :* :.       .  *. *:*.

A0A803T0A4_MCL1-02      DGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
A0A803T0A4_MCL1-01      DGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
A0A803T0A4_MCL1-03      DGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
H9GHK7_BCL2L1-01        DG-VNWGRIVAFFSFGGALCVESVDKEMQGLVVRIASWMTTYLTEHLDPW
H9GPE7_BCL2-01          DG-VNWGRIVAFFEFGGMLCVESVSREMSPLVDNIATWMTEYLNQYLRNW
                        ** :******:::.**. :.    . : .  :  :   :*  *      *

A0A803T0A4_MCL1-02      LLKHNAW----------------QRARLGSATLRIHLEAVTLVFLNFQVQ
A0A803T0A4_MCL1-01      LLKHNAW----------------QRARLGSATLRIHLEAVTLVFLNFQVQ
A0A803T0A4_MCL1-03      LLKHNAW----------------EG----------FVQFFHVEDIEGGIR
H9GHK7_BCL2L1-01        IQENGGW------------------------ERFVDVYGNDAAAKSRKGQ
H9GPE7_BCL2-01          IQENGGWVCGSLSLSFSVSRSYITETSIPVSQMACVTSGSQCGVTCKVVP
                        : ::..*                                           

A0A803T0A4_MCL1-02      AVFVRHGFLGSERGKQQHTCP-----
A0A803T0A4_MCL1-01      AVFVRHGFLGSERGKQQHNCV-----
A0A803T0A4_MCL1-03      NVLVAFASVAGIGAGLAYMIR-----
H9GHK7_BCL2L1-01        ERFNKWLWTGATVAGVVLLGSLLSRK
H9GPE7_BCL2-01          RAFCLFRTKGDN--------QLL---
                          :      .                

© 1998-2022Legal notice