Dataset for protein BCL-2-like of organism Anas platyrhynchos

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9SFH3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anas platyrhynchos GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEA
PPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8B9SM69_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anas platyrhynchos GN=BCL2L1 (length=227 residues).
MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDENRTELASEAAAVLNGSPSWHPPAGQVVNGAAVHRSSLEVHELVQSAAV
RQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VAWMTTYLSDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9SWV2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anas platyrhynchos GN=MCL-1 (length=182 residues).
MFALPRNALIGFNLYCGGGTGPGGGGGGGGGPASPGGTPKALETLRRVGDGVLEKHELAFQGMLRKLEIKKEEDLQAVGE
VAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSI
RNVLMAFAGVAGLGASLAYMIR
© 1998-2023Legal notice