Dataset for protein BCL-2-like of organism Anas platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9SWV2_MCL1-01      ------MFALPRNALIGFNLYCGGGTG-----------------------
A0A8B9SFH3_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAV
A0A8B9SM69_BCL2L1-      ------MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDENRTELASEAAAV
                                   *: :: :  *  .  *                       

A0A8B9SWV2_MCL1-01      ----------PGGG--------GGGGGGPASPG-----GTPKALETLRRV
A0A8B9SFH3_BCL2-01      AAAGTPSRHRPAGLLSPHPEPPGSAAASEAPPGEGLRPAPPVVHLALRQA
A0A8B9SM69_BCL2L1-      -LNGSPSWHPPAGQVV------NGAAVHRSSLEVHELVQSAAVRQALREA
                                  *.*         ....   :.        .. .  :** .

A0A8B9SWV2_MCL1-01      GDGVLEKHELAFQGMLRKLEIKKEEDLQAVGEVAAHLFSDGVTNWGRVVT
A0A8B9SFH3_BCL2-01      GDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGV-NWGRIVA
A0A8B9SM69_BCL2L1-      GDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVA
                        ** .  .:   *  :  :* :.       .  *.  ** *** ****:*:

A0A8B9SWV2_MCL1-01      LISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFV
A0A8B9SFH3_BCL2-01      FFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFV
A0A8B9SM69_BCL2L1-      FFSFGGALCVESVDKEMRVLVGRIVAWMTTYLSDHLDPWIQENGGWERFV
                        ::.**. :.    . :    :. :.  :*  *      *: .:***: **

A0A8B9SWV2_MCL1-01      DFFRVEDLEG------SIRNVLMAFAGVAG---LGASLAYMIR
A0A8B9SFH3_BCL2-01      ELYGNSMRPLFDFSWISLKT-ILSLVLVGACITLGAYLGHK--
A0A8B9SM69_BCL2L1-      DLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK--
                        :::  .          ::.. ::: . *..   **: *.    

© 1998-2023Legal notice