Dataset for protein Mcl-1 of organism Accipiter nisus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9M984_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Accipiter nisus GN=MCL-1 (length=329 residues).
MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPA
ARPGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLFPGLLGGPGRP
GGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHL
KSINQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRLQVPMRIY
CFGKRKWKN
>gnl|bcl2dbpro|A0A8B9M984_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Accipiter nisus GN=MCL-1 (length=477 residues).
MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPA
ARPGALWSPEEELDGCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLFPGLLGGPGRP
GGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHL
KSINQERCISSLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRNVTNCWIP
SLGWQGTEFCSSWDGSCPRPALLLSMPGTLQETWQAHPRSAHSFFLSSSQLKPLSLLVSLCLQSYGDSPWGPEQFLLNKA
TGLGVPSSSSKSCCDSAVLPCAAWLKRCPAALGTRCKPCHPSERLDSLPKSHQCPRNPSEHWGSALFPPSRVHAQGW
© 1998-2022Legal notice