Dataset for protein Mcl-1 of organism Accipiter nisus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9M984_MCL1-02      MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGS
A0A8B9M984_MCL1-01      MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVPGTLIGS
                        **************************************************

A0A8B9M984_MCL1-02      VAAWAAAGRPEHPRALVGCGAAPRAALPPAARPGALWSPEEELDGCEPEA
A0A8B9M984_MCL1-01      VAAWAAAGRPEHPRALVGCGAAPRAALPPAARPGALWSPEEELDGCEPEA
                        **************************************************

A0A8B9M984_MCL1-02      ERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLF
A0A8B9M984_MCL1-01      ERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEPAVKKLF
                        **************************************************

A0A8B9M984_MCL1-02      PGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQ
A0A8B9M984_MCL1-01      PGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGMLRKLEIQ
                        **************************************************

A0A8B9M984_MCL1-02      KEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQERCIS
A0A8B9M984_MCL1-01      KEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSINQERCIS
                        **************************************************

A0A8B9M984_MCL1-02      SLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGV
A0A8B9M984_MCL1-01      SLAGIITDALVSSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGV
                        **************************************************

A0A8B9M984_MCL1-02      AGLGASLAYMIR--------------------------------------
A0A8B9M984_MCL1-01      AGLGASLAYMIRNVTNCWIPSLGWQGTEFCSSWDGSCPRPALLLSMPGTL
                        ************                                      

A0A8B9M984_MCL1-02      -------------------------LQVPMRIYCFGKRKWKN--------
A0A8B9M984_MCL1-01      QETWQAHPRSAHSFFLSSSQLKPLSLLVSLCLQSYGDSPWGPEQFLLNKA
                                                 * *.: : .:*.  *          

A0A8B9M984_MCL1-02      --------------------------------------------------
A0A8B9M984_MCL1-01      TGLGVPSSSSKSCCDSAVLPCAAWLKRCPAALGTRCKPCHPSERLDSLPK
                                                                          

A0A8B9M984_MCL1-02      ---------------------------
A0A8B9M984_MCL1-01      SHQCPRNPSEHWGSALFPPSRVHAQGW
                                                   

© 1998-2022Legal notice