Dataset for protein Bax of organism Cercocebus atys

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5KU58_BAX-04 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=203 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
LLNPPHPNHRPCPTVPAHPLSQWCPLPIFGSSDVVYNAFPYVS
>gnl|bcl2dbpro|A0A2K5KU58_BAX-03 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=185 residues).
MDGSGEQPRGGGEAGGRRAGGGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDS
PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
PTWQTVTILVAGVLTASLTIWKKMG
© 1998-2020Legal notice