Dataset for protein Bax of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5KU58_BAX-04      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPV
A0A2K5KU58_BAX-03      MDGSGEQPRGGGEAGGR---RAGG----GFIQDRAGRMGGETPELALDPV
                       ************ :..    .:*.    **********************

A0A2K5KU58_BAX-04      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
A0A2K5KU58_BAX-03      PQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
                       **************************************************

A0A2K5KU58_BAX-04      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
A0A2K5KU58_BAX-03      SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
                       **************************************************

A0A2K5KU58_BAX-04      WIQDQGGWVRLLNPPHPNHRPCPTVPAHPLSQWCPLPIFGSSDVVYNAFP
A0A2K5KU58_BAX-03      WIQDQGGWDGLL-----------SYFGTPTWQTVTILVAGVLTASLTIWK
                       ********  **           :  . *  *  .: : *   .  . : 

A0A2K5KU58_BAX-04      YVS
A0A2K5KU58_BAX-03      KMG
                        :.

© 1998-2020Legal notice