Dataset for protein classical BH3-containing proteins of organism Vombatus ursinus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A4X2K3J4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Vombatus ursinus GN=HRK (length=97 residues).
MCPCPLHRGRGPPAVCACSSGRLEQRAAAAAQLTAARLKALGDELQERTMWRRRARSRRAAAEAAGSGGGLPACWAWLCA
AAQVAALAAWLLRRRNL
>gnl|bcl2dbpro|A0A4X2KAA5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Vombatus ursinus GN=BAD (length=180 residues).
MSMFQISEFEPSEQETPKEDGFAYAPGESRGLGKHSATAPSLAPVRPGPRPAPGAHHHEGAGAGAGDRRPRLISYPPLRE
GPGEASPEAEAEADFFEGEEERSLFRSRSSSAPPILWAARRYGSELRRMSDEFDCTFKGLPRPKSAGTASQMRRSHGWAR
TFQSWLSRSLGKGSAAGPSH
>gnl|bcl2dbpro|A0A4X2KLG2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Vombatus ursinus GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPVSLRLGEEPPQEQWEHRTEVQIARKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A0A4X2L9J9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L11 (length=141 residues).
MAKQPSDLNSECHREGGQLHPTERPTQPQQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QSIPADMRPEIWIAQELRRIGDEFNAYYPRRGFLDNNYQADHQMVILRLLRYIIRLVWRMQ
>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=232 residues).
MVLEGAAAEPALTCSAHLSPQAPRCGMARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPA
PGPALAPPSLLPLAYFCTRQPRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGV
LGPDHGGQAEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=206 residues).
MARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQPRSYGG
PRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGVLGPDHGGQAEQQDREIGAQLRRMADD
LNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
© 1998-2020Legal notice