Dataset for protein classical BH3-containing proteins of organism Vombatus ursinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X2LVY2_BBC3-01      MVLEGAAAEPALTCSAHLSPQAPRCGMARAQQDGSSREPVEGLPREGPRT
A0A4X2LVY2_BBC3-02      --------------------------MARAQQDGSSREPVEGLPREGPRT
A0A4X2KAA5_BAD-01       -----------------------------------------------MSM
A0A4X2KLG2_BMF-01       ------------------------------------MEPPHYVEELEDDV
A0A4X2K3J4_HRK-01       ---------------------------MCPCPLHRGRGPPAV---CACSS
A0A4X2L9J9_BCL2L11      ----------------------------------MAKQPSDLNSECHREG
                                                                          

A0A4X2LVY2_BBC3-01      FPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQ
A0A4X2LVY2_BBC3-02      FPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQ
A0A4X2KAA5_BAD-01       FQISEFEPSEQETPKEDGFAYAPGE-----S-------------------
A0A4X2KLG2_BMF-01       FHPEDSEPGAQPGGLTSAALFAQSQ-----PDYMLDGLQLFPLTHCCGPG
A0A4X2K3J4_HRK-01       GRLE--QRAAAAAQLTAARLKALGDELQERT------------------M
A0A4X2L9J9_BCL2L11      GQLHPTERPTQPQQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQA
                                         .   .        .                   

A0A4X2LVY2_BBC3-01      PRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGA
A0A4X2LVY2_BBC3-02      PRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGA
A0A4X2KAA5_BAD-01       -RGLG--KHSATAPSLAPVRPGPR---PAPGAHHHEGAGAGAGDRRP---
A0A4X2KLG2_BMF-01       LRSVG--QEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRL---
A0A4X2K3J4_HRK-01       WR-----RRARSRRAAAEAAGSGGGL-PAC--------------------
A0A4X2L9J9_BCL2L11      FN-----HYLSAMASMRQSQSIPADMRPEI--------------------
                         .     .      :            *                      

A0A4X2LVY2_BBC3-01      SPMSGGPPGVLGPDHGGQAEQQDR--------------------------
A0A4X2LVY2_BBC3-02      SPMSGGPPGVLGPDHGGQAEQQDR--------------------------
A0A4X2KAA5_BAD-01       -RLISYPPLREGPGEASPEAEAEADFFEGEEERSLFRSRSSSAPPILWAA
A0A4X2KLG2_BMF-01       -PLPANFPVSLRLGEEPPQEQ--------------------------WEH
A0A4X2K3J4_HRK-01       --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
                                                                          

A0A4X2LVY2_BBC3-01      ----EIGAQLRRMADDLNALY------EQRRREEEQRRHLSPWRLLYNLV
A0A4X2LVY2_BBC3-02      ----EIGAQLRRMADDLNALY------EQRRREEEQRRHLSPWRLLYNLV
A0A4X2KAA5_BAD-01       R---RYGSELRRMSDEFDCTFKGLPRPKSAGTASQMRRSHGWARTFQSWL
A0A4X2KLG2_BMF-01       RTEVQIARKLQCIADQFH---------RLHMQRHQQNRNHVWWQILLFLH
A0A4X2K3J4_HRK-01       ----WAWLCAAAQVAALAAWLLRRRNL-----------------------
A0A4X2L9J9_BCL2L11      ----WIAQELRRIGDEFNAYYPRRGFLDNNYQADHQMVILRLLRYIIRLV
                                        :                                 

A0A4X2LVY2_BBC3-01      SGLLAPHRGNRIPEIEPN-
A0A4X2LVY2_BBC3-02      SGLLAPHRGNRIPEIEPN-
A0A4X2KAA5_BAD-01       S--RSLGKG---SAAGPSH
A0A4X2KLG2_BMF-01       N--LALNREENRNGAGPR-
A0A4X2K3J4_HRK-01       -------------------
A0A4X2L9J9_BCL2L11      WRMQ---------------
                                           

© 1998-2020Legal notice