Dataset for protein Puma of organism Vombatus ursinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=232 residues).
MVLEGAAAEPALTCSAHLSPQAPRCGMARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPA
PGPALAPPSLLPLAYFCTRQPRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGV
LGPDHGGQAEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=206 residues).
MARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQPRSYGG
PRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGVLGPDHGGQAEQQDREIGAQLRRMADD
LNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
© 1998-2020Legal notice