Dataset for protein Puma of organism Vombatus ursinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X2LVY2_BBC3-01      MVLEGAAAEPALTCSAHLSPQAPRCGMARAQQDGSSREPVEGLPREGPRT
A0A4X2LVY2_BBC3-02      --------------------------MARAQQDGSSREPVEGLPREGPRT
                                                  ************************

A0A4X2LVY2_BBC3-01      FPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQ
A0A4X2LVY2_BBC3-02      FPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQ
                        **************************************************

A0A4X2LVY2_BBC3-01      PRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGA
A0A4X2LVY2_BBC3-02      PRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGA
                        **************************************************

A0A4X2LVY2_BBC3-01      SPMSGGPPGVLGPDHGGQAEQQDREIGAQLRRMADDLNALYEQRRREEEQ
A0A4X2LVY2_BBC3-02      SPMSGGPPGVLGPDHGGQAEQQDREIGAQLRRMADDLNALYEQRRREEEQ
                        **************************************************

A0A4X2LVY2_BBC3-01      RRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
A0A4X2LVY2_BBC3-02      RRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
                        ********************************

© 1998-2020Legal notice