Dataset for protein Bad of organism Takifugu rubripes

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A674MXC1_BAD-04 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
>gnl|bcl2dbpro|A0A674MXC1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
>gnl|bcl2dbpro|A0A674MXC1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
>gnl|bcl2dbpro|A0A674MXC1_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNGEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
© 1998-2021Legal notice