Dataset for protein Bad of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674MXC1_BAD-02      MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTG
A0A674MXC1_BAD-03      MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTG
A0A674MXC1_BAD-04      MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTG
A0A674MXC1_BAD-01      MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTG
                       **************************************************

A0A674MXC1_BAD-02      TSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGRSRSAPPALW
A0A674MXC1_BAD-03      TSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGRSRSAPPALW
A0A674MXC1_BAD-04      TSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGRSRSAPPALW
A0A674MXC1_BAD-01      TSRTRVSSESQASTFSREEELQGNGEDEAGTPTEGAPFRGRSRSAPPALW
                       **************************************************

A0A674MXC1_BAD-02      AAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSH
A0A674MXC1_BAD-03      AAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSH
A0A674MXC1_BAD-04      AAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSH
A0A674MXC1_BAD-01      AAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSH
                       **************************************************

A0A674MXC1_BAD-02      QETEGENGHHDGHTHRTE
A0A674MXC1_BAD-03      QETEGENGHHDGHTHRTE
A0A674MXC1_BAD-04      QETEGENGHHDGHTHRTE
A0A674MXC1_BAD-01      QETEGENGHHDGHTHRTE
                       ******************

© 1998-2020Legal notice